84-3676-90 ANXA4 (Annexin A4, Annexin-4, Annexin IV, Lipocortin IV, Endonexin I, Chromobindin-4, Protein II, P32.5, Placental Anticoagulant Protein II, PAP-II, PP4-X, 35-beta Calcimedin, Carbohydrate-binding Protein p33/p41, ANX4) (Biotin) 100ul 137545-Biotin
84-3676-90 ANXA4 (Annexin A4, Annexin-4, Annexin IV, Lipocortin IV, Endonexin I, Chromobindin-4, Protein II, P32.5, Placental Anticoagulant Protein II, PAP-II, PP4-X, 35-beta Calcimedin, Carbohydrate-binding Protein p33/p41, ANX4) (Biotin) 100ul 137545-Biotin
Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins.
Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways.
ANXA4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization.
Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity.
ANXA4 is almost exclusively expressed in epithelial cells.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 1.25ug/mlImmunohistochemistry: 4-8ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Specificity:Recognizes Annexin A4. Species Crossreactivity: Human, rat and canine.
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Ca Hu Rt
Immunogen:N-terminus of ANXA4 corresponding to GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ