Epidermal growth factor like repeats are a class of cysteine-rich domains that mediate interactions between proteins of diverse function.
EGF domains are found in proteins that are either completely secreted or have transmembrane regions that tether the protein to the cell surface.
CRELD1 is the founding member of a family of matricellular proteins.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: APC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2, 0.09% sodium azide and a stabilizer. Labeled with Allophycocyanin (APC).
Specificity:Recognizes human CRELD1.
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region: TEVCPGENKQCENTEGGYRCICAEGYKQMEGICVKEQIPESAGFFSEMTE corresponding to the C-terminal region of human CRELD1. Species sequence homology: bovine, canine, guinea pig, equine, mouse and rat