The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors.
It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes.
The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Specificity:Recognizes human RORA.
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP corresponding to the middle region of human RORA. Species sequence homology: bovine, canine, goat, guinea pig, equine, mouse, rabbit, rat, sheep and zebrafish