84-3666-72 [取扱停止]RHAG (Ammonium Transporter Rh Type A, Erythrocyte Membrane Glycoprotein Rh50, Erythrocyte Plasma Membrane 50kD Glycoprotein, Rh50A, Rhesus Blood Group Family Type A Glycoprotein, Rh Family Type A Glycoprotein, Rh Type A Glycoprotein, Rhesus Blood Group-associated Ammonia Channel, Rhesus Blood Group-associated Glycoprotein, CD241, RH50) (AP) 100ul 138287-AP
84-3666-72 [取扱停止]RHAG (Ammonium Transporter Rh Type A, Erythrocyte Membrane Glycoprotein Rh50, Erythrocyte Plasma Membrane 50kD Glycoprotein, Rh50A, Rhesus Blood Group Family Type A Glycoprotein, Rh Family Type A Glycoprotein, Rh Type A Glycoprotein, Rhesus Blood Group-associated Ammonia Channel, Rhesus Blood Group-associated Glycoprotein, CD241, RH50) (AP) 100ul 138287-AP
The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30kD, the so-called Rh30 polypeptides.
Heterogeneously glycosylated membrane proteins of 50 and 45kD, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies.
The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 1.25ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Specificity:Recognizes human RHAG.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Middle region of RHAG corresponding to FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG