Alpha crystallins are composed of: alpha-A and alpha-B, for acidic and basic, respectively.
They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates.
Post-translational modifications decrease the ability to chaperone.
Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture.
Alpha-A and alpha-B are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs.
Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Specificity：Recognizes crystallin Alpha B. Species Crossreactivity: Human and mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：C-terminus of CRYAB corresponding to KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVT
