Transient receptor potential cation channel subfamily V member 5 is a protein that in humans is encoded by the TRPV5 gene.
This gene is a member of the transient receptor family and the TrpV subfamily.
The calcium-selective channel encoded by this gene has 6 transmembrane- spanning domains, multiple potential phosphorylation sites, an N-linked glycosylation site, and 5 ANK repeats.
And this protein forms homotetramers or heterotetramers and is activated by a low internal calcium level.
In addition, TRPV5 is mainly expressed in kidney epithelial cells, where it plays an important role in the reabsorption of Ca2+.
Genetic deletion of TRPV5 in mice leads to Ca2+ loss in the urine, and consequential hyperparathyroidism, and bone loss.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human TRPV5. Species Crossreactivity: rat
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Rt
Immunogen：Synthetic peptide corresponding to aa580-610, DTHWRVAQERDELWRAQVVATTVMLERKLPR, from human TRPV5 at C-terminus, different from the related mouse and rat sequences by 1aa.
