SPARC, secreted protein acidic and rich in cysteine, also known as Osteonectin, is a protein that in humans is encoded by the SPARC gene.
The human SPARC gene is 26.5kb long, and contains 10 exons and 9 introns and is located on chromosome 5q31-q33.
SPARC is a glycoprotein of 40kD.
SPARC is an acidic, cysteine-rich glycoprotein consisting of a single polypeptide chain that can be broken into 4 domains: 1) an Ca++ binding domains near the glutamic acidic-rich region at the amino terminus (domain I), 2) a cysteine-rich (domain II), 3) a hydrophilic region (domain III) and 4) an EF hand motif at the carboxy terminus region (domain IV).
Osteonectin is a glycoprotein in the bone that binds sodium.
It is secreted by osteoblasts during bone formation, initiating mineralization and promoting mineral crystal formation.
Osteonectin also shows affinity for collagen in addition to bone mineral calcium.
A correlation between osteonectin over expression and ampullary cancers and chronic pancreatitis has been found.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity:Recognizes human SPARC.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa268-303, RFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI, from human SPARC at C-terminus, different from the related mouse and rat sequences by 4aa.