SP1(transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism.
It belongs to the Sp/KLF family of transcription factors.
The protein is 785aa long, with a molecular weight of 81kD.
By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13.
By in situ hybridization, Gaynor et al.
(1993) concluded that 12q13.1 is the most probable location of the SP1 gene.
Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm.
The formation of 7 head segments depends on the function of several genes.
Wimmer et al.
(1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.1ng/lane under reducing conditions
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human SP1.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa52-785, EAICPEGIARLANSGINVMQVADLQSINISGNGF, from human SP1 at C-terminus, different from the related mouse and rat sequences by 2aa.
