Solute carrier family 12 (sodium/potassium/chloride transporters), member 1, also called NKCC2 is specifically found in cells of the thick ascending limb of the loop of Henle in nephrons, the basic functional units of the kidney.
This gene is mapped to 15q21.1.
This gene encodes a kidney-specific sodium-potassium-chloride cotransporter that is expressed on the luminal membrane of renal epithelial cells of the thick ascending limb of Henle's loop and the macula densa.
It plays a key role in concentrating urine and accounts for most of the NaCl resorption.
It is sensitive to such diuretics as furosemide and bumetanide.
Some Bartter-like syndromes result from defects in this gene.
This gene plays a vital role in the regulation of ionic balance and cell volume.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.1ng/lane under reducing conditions
Immunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human SLC12A1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa52-83, DEAQKRLRISFRPGNQECYDNFLQSGETAKTD, from human SLC12A1 at N-terminus, different from the related mouse sequence by 2aa, and from the related rat sequence by 4aa.
Shelf Life：1year
Swiss Prot Number：Q13621
EU Commodity Code：30021010
商品名：SLC12A1 (BSC1, Bumetanide Sensitive Sodium 3, Bumetanide-sensitive Sodium-(potassium)-chloride Cotransporter 2, Kidney Specific Na K Cl Symporter, Kidney-specific Na-K-Cl Symporter, Na K 2Cl Cotransporter, NKCC2, Potassium Chloride Cotransporter 2, S12A1_HUMAN, Slc12a1, Sodium Potassium Chloride Cotransporter 2, Solute Carrier Family 12 (Sodium/Potassium/Chloride Transporters), Solute Carrier Family 12 Member 1) 100ug
