SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene.
This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells.
The SERCA1 gene is mapped to 16p11.2.
This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction.
It has been determined that the human SERCA1 gene is 26kb long and contains 23 exons, of which can be alternatively spliced.
Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.
Applications:Suitable for use in Western Blot and Immunohistochemistry (paraffin).
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human ATP2A1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa1-32, MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN, from human ATP2A1 at N-terminal, different from the related mouse and rat sequences by 3aa.
Shelf Life：1year
Swiss Prot Number：O14983
EU Commodity Code：30021010
商品名：SERCA1, NT (ATP2A1, Fast Twitch Skeletal Muscle Isoform, AT2A1_HUMAN, ATP2A, ATPase Ca++ Transporting Cardiac Muscle Fast Twitch 1, ATPase Ca++ Transporting Fast Twitch 1, ATPase, Ca(2+)-transporting Fast Twitch 1, Calcium Pump 1, Calcium Transporting ATPase Sarcoplasmic Reticulum Type Fast Twitch Skeletal Muscle Isoform, Calcium-transporting ATPase Sarcoplasmic Reticulum Type, Endoplasmic Reticulum Class 1/2 Ca(2+) ATPase, Fast Skeletal Muscle SR Calcium ATPase, Sarcoendoplasmic Reticulum Calcium ATPase, Sarcoplasmic Reticulum Ca(2+)-ATPase 1, Sarcoplasmic/Endoplasmic Reticulum Calcium ATPase 1, SERCA 1, SERCA1 Truncated Isoform, Included, SR Ca(2+) ATPase 1, SR Ca(2+)-ATPase 1) 100ug
