Runt-related transcription factor 1 (RUNX1), also known as AML1 or CBFA2, is a protein that in humans is encoded by the RUNX1 gene.
It belongs to the Runt-related transcription factor (RUNX) family of genes which are also called core binding factor-alpha (CBFa).
RUNX1 is mapped to 21q22.12.
RUNX1 is a transcription factor that regulates the differentiation of hematopoietic stem cells into mature blood cells.
RUNX proteins form a heterodimeric complex with CBFbeta which confers increased DNA binding and stability to the complex.
Chromosomal translocations involving the RUNX1 gene are associated with several types of leukemia including M2 AML.
Mutations in RUNX1 are implicated in cases of breast cancer.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.25ng/lane under reducing conditions
Immunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human RUNX1. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa200-233, ELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFN, from the middle region of human RUNX1, identical to the related mouse and rat sequences.
Shelf Life：1year
Swiss Prot Number：Q01196
EU Commodity Code：30021010
商品名：RUNX1 (Acute Myeloid Leukemia 1, Acute Myeloid Leukemia 1 Protein, Alpha Subunit, Alpha Subunit Core Binding Factor, AML 1, AML1, AML1 EVI 1, AML1 EVI 1 Fusion Protein, Aml1 Oncogene, AMLCR 1, AMLCR1, CBF alpha 2, CBF-alpha-2, CBFA 2, CBFA2, Core Binding Factor alpha 2 Subunit, Core Binding Factor Runt Domain alpha Subunit 2, Core-binding Factor Subunit alpha-2, EVI 1, EVI1, Oncogene AML 1, Oncogene AML-1, PEA2 alpha B, PEA2-alpha B, PEBP2 alpha B, PEBP2-alpha B, PEBP2A2, PEBP2aB, Polyomavirus Enhancer Binding Protein 2 alpha B Subunit, Polyomavirus Enhancer-binding Protein 2 alpha B Subunit, Run1, Runt Related Transcription Factor 1, Runt-related Transcription Factor 1, RUNX 1, Runx1, RUNX1_HUMAN, SL3 3 Enhancer Factor 1 alpha B Subunit, SL3-3 Enhancer Factor 1 alpha B Subunit, SL3/AKV Core Binding Factor alpha B Subunit, SL3/AKV Core-binding Factor alpha B Subunit) 100ug
