P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene.
It is mapped to 7q21.12.
P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily.
It is an important protein of the cell membrane that pumps many foreign substances out of cells.
More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity.
P-GP is an ATP-dependent drug efflux pump for xenobiotic compounds with broad substrate specificity.
It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs.
This protein also functions as a transporter in the blood–brain barrier.
Applications:Suitable for use in Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Immunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Immunohistochemistry (frozen): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder in 0.2mg Na2HPO4, 5mg BSA, 0.9mg sodium chloride, 0.05mg Thimerosal, 0.05mg sodium azide. Reconstitute with 200ul sterile dH2O to 0.5mg/ml.
Specificity：Recognizes human P Glycoprotein. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa621-650 from the middle region of human P Glycoprotein (IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by 12aa.
