84-3434-07 Osteopontin, CT (BNSP, Bone Sialoprotein 1, BSP I, BSPI, Early T Lymphocyte Activation 1, ETA 1, ETA1, Nephropontin, OPN, Osteopontin/Immunoglobulin alpha 1 Heavy Chain Constant Region Fusion Protein, OSTP_HUMAN, Secreted Phosphoprotein 1 (Osteopontin, Bone Sialoprotein I, Early T-lymphocyte Activation 1), Secreted Phosphoprotein 1, SPP 1, SPP-1, SPP1, SPP1/CALPHA1 Fusion, Urinary Stone Protei ... 303503
84-3434-07 Osteopontin, CT (BNSP, Bone Sialoprotein 1, BSP I, BSPI, Early T Lymphocyte Activation 1, ETA 1, ETA1, Nephropontin, OPN, Osteopontin/Immunoglobulin alpha 1 Heavy Chain Constant Region Fusion Protein, OSTP_HUMAN, Secreted Phosphoprotein 1 (Osteopontin, Bone Sialoprotein I, Early T-lymphocyte Activation 1), Secreted Phosphoprotein 1, SPP 1, SPP-1, SPP1, SPP1/CALPHA1 Fusion, Urinary Stone Protei ... 303503
Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1).
The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix.
And the encoded protein is secreted and binds hydroxyapatite with high affinity.
The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein.
Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12.
Several transcript variants encoding different isoforms have been found for this gene.
Applications:Suitable for use in ELISA and Western Blot.
Other applications not tested.
Recommended Dilution:ELISA: 0.1-0.5ug/mlWestern Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity:Recognizes human Osteopontin. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:E WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa281-314, HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN, from human Osteopontin at C-terminus, different from the related mouse sequence by 8aa, and from the related rat sequence by 7aa.
Shelf Life:1year
Swiss Prot Number:P10451
EU Commodity Code:30021010
商品名:Osteopontin, CT (BNSP, Bone Sialoprotein 1, BSP I, BSPI, Early T Lymphocyte Activation 1, ETA 1, ETA1, Nephropontin, OPN, Osteopontin/Immunoglobulin alpha 1 Heavy Chain Constant Region Fusion Protein, OSTP_HUMAN, Secreted Phosphoprotein 1 (Osteopontin, Bone Sialoprotein I, Early T-lymphocyte Activation 1), Secreted Phosphoprotein 1, SPP 1, SPP-1, SPP1, SPP1/CALPHA1 Fusion, Urinary Stone Protein, Uropontin) 100ug