84-3433-85 Neuropeptide Y (C-flanking Peptide of NPY, CPON, Neuropeptide Tyrosine, Neuropeptide Y Precursor, NPY, NPY_HUMAN, Pro Neuropeptide Y, PYY 4, PYY4, Y Neuropeptide) 100ug 303478
84-3433-85 Neuropeptide Y (C-flanking Peptide of NPY, CPON, Neuropeptide Tyrosine, Neuropeptide Y Precursor, NPY, NPY_HUMAN, Pro Neuropeptide Y, PYY 4, PYY4, Y Neuropeptide) 100ug 303478
This gene encodes a neuropeptide that is widely expressed in the central nervous system and influences many physiological processes, including cortical excitability, stress response, food intake, circadian rhythms, and cardiovascular function.
The neuropeptide functions through G protein-coupled receptors to inhibit adenylyl cyclase, activate mitogen-activated protein kinase (MAPK), regulate intracellular calcium levels, and activate potassium channels.
A polymorphism in this gene resulting in a change of leucine 7 to proline in the signal peptide is associated with elevated cholesterol levels, higher alcohol consumption, and may be a risk factor for various metabolic and cardiovascular diseases.
The protein also exhibits antimicrobial activity against bacteria and fungi.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.1ng/lane under reducing conditions
Immunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity:Recognizes human Neuropeptide Y. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa29-64, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY, from the middle region of human Neuropeptide Y, identical to the related mouse and rat sequences.