The protein encoded by this gene is a member of the MAP kinase family.
MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development.
This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli.
It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway.
Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases.
This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells.
Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation.
Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human JNK2.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa257-288, RNYVENRPKYPGIKFEELFPDWIFPSESERDK, from the middle region of human JNK2, identical to the related mouse and rat sequences.
Shelf Life：1year
Swiss Prot Number：P45984
EU Commodity Code：30021010
商品名：JNK2 (C Jun Kinase 2, C Jun N Terminal Kinase 2, C-Jun N-terminal Kinase 2, JNK 55, JNK-55, JNK2 alpha, JNK2 beta, JNK2A, JNK2alpha, JNK2B, JNK2BETA, Jun Kinase, MAP Kinase 9, MAPK 9, Mapk9, Mitogen Activated Protein Kinase 9, Mitogen-activated Protein Kinase 9, MK09_HUMAN, P54a, p54aSAPK, PRKM9, SAPK alpha, SAPK, SAPK1a, Stress Activated Protein Kinase 1a, Stress-activated Protein Kinase JNK2) 100ug
