HIF-1a (Hypoxia-inducible factor 1alpha, HIF1A) is a transcription factor that mediates cellular and systemic homeostatic responses to reduced O2 availability in mammals, including angiogenesis, erythropoiesis and glycolysis.
This gene was mapped to 14q21-q24.
HIF-1a transactivate genes required for energy metabolism and tissue perfusion and is necessary for embryonic development and tumor explant growth.
HIF-1alpha is over expressed during carcinogenesis, myocardial infarction and wound healing.
It is crucial for the cellular response to hypoxia and is frequently over expressed in human cancers, resulting in the activation of genes essential for cell survival.
HIF-1a regulates the survival and function in the inflammatory microenvironment directly.
It is a transcription factor that plays a pivotal role in cellular adaptation to changes in oxygen availability.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.25ng/lane under reducing conditions
Immunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human HIF-1-alpha. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa703-732, EEELNPKILALQNAQRKRKMEHDGSLFQAV, human HIF-1-alpha at C-terminal, different from the related mouse and rat sequences by 3aa.
Shelf Life：1year
Swiss Prot Number：Q16665
EU Commodity Code：30021010
商品名：HIF1A, CT (HIF-1-alpha, ARNT Interacting Protein, ARNT-interacting Protein, Basic Helix Loop Helix PAS Protein MOP1, Basic-helix-loop-helix-PAS Protein MOP1, Class E Basic Helix-loop-helix Protein 78, HIF 1A, HIF 1alpha, HIF1 A, HIF1 Alpha, HIF1, HIF1-alpha, HIF1A_HUMAN, Hypoxia Inducible Factor 1 alpha, Hypoxia Inducible Factor 1 alpha Isoform I.3, Hypoxia Inducible Factor 1 alpha Subunit, Hypoxia Inducible Factor 1 alpha Subunit Basic Helix Loop Helix Transcription Factor, Hypoxia Inducible Factor 1, alpha Subunit (Basic Helix Loop Helix Transcription Factor), Hypoxia Inducible Factor1alpha, Hypoxia-inducible Factor 1-alpha, Member of PAS Protein 1, Member of PAS Superfamily 1, Member of the PAS Superfamily 1, MOP 1, MOP1, PAS Domain-containing Protein 8, PASD 8, PASD8) 100ug
