CD36 (cluster of differentiation 36), also known as FAT (fatty acid translocase), FAT/CD36, (FAT)/CD36, SCARB3, GP88, glycoprotein IV (gpIV), and glycoprotein IIIb (gpIIIb), is an integral membrane protein found on the surface of many cell types in vertebrate animals.
CD36 is a member of the class B scavenger receptor family of cell surface proteins.
It is mapped to 7q21.11.
And CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids.
In addition, CD36 function in long-chain fatty acid uptake and signaling can be irreversibly inhibited by sulfo-N-succinimidyl oleate (SSO), which binds lysine 164 within a hydrophobic pocked shared by several CD36 ligands, e.g.
fatty acid and oxLDL.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human CD36. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa31-66, DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW, from human CD36 at N-terminus, different from the related mouse sequence by 6aa, and from the related rat sequence by 4aa.
Shelf Life：1year
Swiss Prot Number：P16671
EU Commodity Code：30021010
商品名：CD36, NT (Adipocyte Membrane Protein, CD36 Antigen (Collagen Type I Receptor, Thrombospondin Receptor), CD36 Antigen, CD36 Molecule (Thrombospondin Receptor), CD36 Molecule, CD36_HUMAN, CHDS7, Cluster Determinant 36, Collagen Receptor, Platelet, FAT, Fatty Acid Translocase, Fatty Acid Transport Protein, Glycoprotein IIIb, GP IIIb, GP3B, GP4, GPIIIB, GPIV, Leukocyte Differentiation Antigen CD36, PAS 4 Protein, PAS IV, PAS-4, PASIV, Platelet Collagen Receptor, Platelet Glycoprotein 4, Platelet Glycoprotein IV, Scarb3, Scavenger Receptor Class B Member 3, Thrombospondin Receptor) 100ug
