84-3431-05 Bmi1 (B Lymphoma Mo MLV Insertion Region (Mouse), B Lymphoma Mo MLV Insertion Region 1 Homolog, Bmi 1, BMI1, BMI1 Polycomb Ring Finger Oncogene, BMI1_HUMAN, Flvi 2/Bmi 1, FLVI2/BMI1, Murine Leukemia Viral (Bmi 1) Oncogene Homolog, Oncogene BMI 1, PCGF 4, PCGF4, Polycomb Complex Protein BMI 1, Polycomb Complex Protein BMI-1, Polycomb Group Protein Bmi1, Polycomb Group Ring Finger 4, Polycomb Gr ... 303155
84-3431-05 Bmi1 (B Lymphoma Mo MLV Insertion Region (Mouse), B Lymphoma Mo MLV Insertion Region 1 Homolog, Bmi 1, BMI1, BMI1 Polycomb Ring Finger Oncogene, BMI1_HUMAN, Flvi 2/Bmi 1, FLVI2/BMI1, Murine Leukemia Viral (Bmi 1) Oncogene Homolog, Oncogene BMI 1, PCGF 4, PCGF4, Polycomb Complex Protein BMI 1, Polycomb Complex Protein BMI-1, Polycomb Group Protein Bmi1, Polycomb Group Ring Finger 4, Polycomb Gr ... 303155
BMI1(BMI1 polycomb ring finger oncogene), also known as RNF51, is a protein which in humans is encoded by the BMI1 gene.
The Bmi1 gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain.
By fluorescence in situ hybridization, the human BMI1 gene is assigned to chromosome 10p13.
BMI1 has a key role in regulating the proliferative activity of normal stem and progenitor cells.
Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia.
Complementation studies showed that BMI1 completely rescues these proliferative defects.
Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16 (INK4).
BMI1 selectively extended the life span of these cultures.
Confocal microscopy showed that BMI1 transiently colocalized with centromeres during interphase in HeLa cells.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/ml, the detection limit is ~0.25ng/lane under reducing conditions
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity:Recognizes human Bmi1. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa135-165, IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR, from the middle region of human Bmi1, different from the related mouse sequence by 4aa.
Shelf Life:1year
Swiss Prot Number:P35226
EU Commodity Code:30021010
商品名:Bmi1 (B Lymphoma Mo MLV Insertion Region (Mouse), B Lymphoma Mo MLV Insertion Region 1 Homolog, Bmi 1, BMI1, BMI1 Polycomb Ring Finger Oncogene, BMI1_HUMAN, Flvi 2/Bmi 1, FLVI2/BMI1, Murine Leukemia Viral (Bmi 1) Oncogene Homolog, Oncogene BMI 1, PCGF 4, PCGF4, Polycomb Complex Protein BMI 1, Polycomb Complex Protein BMI-1, Polycomb Group Protein Bmi1, Polycomb Group Ring Finger 4, Polycomb Group RING Finger Protein 4, RING Finger Protein 51, RNF 51, RNF51) 100ug