Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is an enzyme that in humans is encoded by the ATP2A3 gene.
It is mapped to 17p13.2.
This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells.
ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte.
The expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells.
This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.
Applications:Suitable for use in Western Blot and Immunohistochemistry (paraffin).
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/mlOptimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months at -20°C.
Reconstitute with sterile dH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size：100ug
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity：Recognizes human ATP2A3. Species Crossreactivity: mouse and rat
Isotype：IgG
Calc Applications Abbrev：IHC WB
Calc Crossreactivity：Hu Mo Rt
Immunogen：Synthetic peptide corresponding to aa1-30, MEAAHLLPAADVLRHFSVTAEGGLSPAQVT, from human ATP2A3 at N-terminal, different from the related mouse sequence by 5aa, and from the related rat sequence by 6aa.
