84-3430-78 Aquaporin 1, CT (AQP 1, AQP CHIP, AQP-1, AQP1, Aquaporin CHIP, Aquaporin-1, Aquaporin-CHIP, Aquaporin1, Channel Forming Integral Protein 28kD, Channel Like Integral Membrane Protein 28kD, CHIP 28, CHIP28, CO, Colton Blood Group, Growth Factor Induced Delayed Early Response Protein, Urine Water Channel, Water Channel Protein CHIP 29, Water Channel Protein CHIP29, Water Channel Protein for Red B ... 303127
84-3430-78 Aquaporin 1, CT (AQP 1, AQP CHIP, AQP-1, AQP1, Aquaporin CHIP, Aquaporin-1, Aquaporin-CHIP, Aquaporin1, Channel Forming Integral Protein 28kD, Channel Like Integral Membrane Protein 28kD, CHIP 28, CHIP28, CO, Colton Blood Group, Growth Factor Induced Delayed Early Response Protein, Urine Water Channel, Water Channel Protein CHIP 29, Water Channel Protein CHIP29, Water Channel Protein for Red B ... 303127
Aquaporin 1 is a 28kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules.
AQP1 is also expressed by the choroid plexus and various other tissues.
It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.
Applications:Suitable for use in Western Blot and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:Western Blot: 0.1-0.5ug/mlImmunohistochemistry (paraffin): 0.5-1ug/ml, boiling the paraffin sections in 10mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections
Optimal dilutions to be determined by the researcher.
Storage and Stability:Lyophilized powder may be stored at -20°C.
Stable for 12 months after receipt at -20°C.
Reconstitute with sterile ddH2O.
Aliquot to avoid repeated freezing and thawing.
Store at -20°C.
Reconstituted product is stable for 12 months at -20°C.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Further dilutions can be made in assay buffer.
仕様
Size:100ug
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile dH2O.
Specificity:Recognizes human Aquaporin 1. Species Crossreactivity: mouse and rat
Isotype:IgG
Calc Applications Abbrev:IHC WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Synthetic peptide corresponding to aa240-269, DRVKVWTSGQVEEYDLDADDINSRVEMKPK, from human Aquaporin 1 at C-terminus, different from the related mouse and rat sequences by 1aa.
Shelf Life:1year
Swiss Prot Number:P29972
EU Commodity Code:30021010
商品名:Aquaporin 1, CT (AQP 1, AQP CHIP, AQP-1, AQP1, Aquaporin CHIP, Aquaporin-1, Aquaporin-CHIP, Aquaporin1, Channel Forming Integral Protein 28kD, Channel Like Integral Membrane Protein 28kD, CHIP 28, CHIP28, CO, Colton Blood Group, Growth Factor Induced Delayed Early Response Protein, Urine Water Channel, Water Channel Protein CHIP 29, Water Channel Protein CHIP29, Water Channel Protein for Red Blood Cells and Kidney Proximal Tubule) 100ug