MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection.
Human interleukin-21 receptor (IL-21R) is a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.
Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
Applications:Suitable for use in FLISA and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:FLISA: 1:50,000Immunohistochemistry (Paraffin): 1:150Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™490 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:goat
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. Labeled with MaxLight™490.
Specificity:Recognizes an epitope within the N-terminal region of human Interleukin-21 Receptor.
Isotype:IgG
Calc Applications Abbrev:FLISA IHC
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa35-65, CILEMWNLHPSTLTLTWQDQYEELKDEATS, within the N-terminal region of human IL-21R.