Human interleukin-21 receptor (IL-21R) is a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.
Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
Applications:Suitable for use in ELISA and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:ELISA: 1:50,000Immunohistochemistry (Paraffin): 1:150Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: PE conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：goat
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. Labeled with R-Phycoerythrin (PE).
Specificity：Recognizes an epitope within the N-terminal region of human Interleukin-21 Receptor.
Isotype：IgG
Calc Applications Abbrev：E IHC
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa35-65, CILEMWNLHPSTLTLTWQDQYEELKDEATS, within the N-terminal region of human IL-21R.
