Human interleukin-21 receptor (IL-21R) is a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.
Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
Applications:Suitable for use in ELISA and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:ELISA: 1:50,000Immunohistochemistry (Paraffin): 1:150Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:goat
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. Labeled with Fluorescein isothiocyanate (FITC).
Specificity:Recognizes an epitope within the N-terminal region of human Interleukin-21 Receptor.
Isotype:IgG
Calc Applications Abbrev:E IHC
Calc Crossreactivity:Hu
Immunogen:Synthetic peptide corresponding to aa35-65, CILEMWNLHPSTLTLTWQDQYEELKDEATS, within the N-terminal region of human IL-21R.