Human interleukin-21 receptor (IL-21R) is a type I transmembrane protein and member of the type I cytokine receptor family, selectively expressed by lymphoid tissues, which acts as the receptor for IL-21.
Interaction between IL-21R and IL-21 results in the activation of several downstream signalling molecules including JAK1 and STAT1, and plays an essential role in the differentiation and proliferation of B cells, T cells and natural killer (NK) cells.
Applications:Suitable for use in ELISA and Immunohistochemistry.
Other applications not tested.
Recommended Dilution:ELISA: 1:50,000Immunohistochemistry (Paraffin): 1:150Optimal dilutions to be determined by the researcher.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：goat
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. Labeled with Biotin.
Specificity：Recognizes an epitope within the N-terminal region of human Interleukin-21 Receptor.
Isotype：IgG
Calc Applications Abbrev：E IHC
Calc Crossreactivity：Hu
Immunogen：Synthetic peptide corresponding to aa35-65, CILEMWNLHPSTLTLTWQDQYEELKDEATS, within the N-terminal region of human IL-21R.
