MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection.
Applications:Suitable for use in Western Blot and Immunoprecipitation.
Other applications have not been tested.
Recommended Dilution:Western Blot: 0.1–2ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells.
3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1ug/ml).
Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemilum-inescence detection system.
Immunoprecipitation Kinase Assay: 4ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
Optimal dilutions to be determined by the researcher.
Positive Antigen Control for Western Blot:3T3/A31 cell lysate.
Use 20ug per lane for minigels.
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™550 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：rat
Grade：Affinity Purified
Purity：Purified by immunoaffinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Specificity：Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species Crossreactivity: Human, mouse, chicken and starfish. Species Sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35
Isotype：IgG
Calc Applications Abbrev：IP WB
Calc Crossreactivity：Ch Hu Mo Rt
Immunogen：Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled)
