Applications:Suitable for use in Western Blot and Immunoprecipitation.
Other applications have not been tested.
Recommended Dilution:Western Blot: 0.1–2ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells.
3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1ug/ml).
Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemilum-inescence detection system.
Immunoprecipitation Kinase Assay: 4ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
Optimal dilutions to be determined by the researcher.
Positive Antigen Control for Western Blot:3T3/A31 cell lysate.
Use 20ug per lane for minigels.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:rat
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Specificity:Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species Crossreactivity: Human, mouse, chicken and starfish. Species Sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35
Isotype:IgG
Calc Applications Abbrev:IP WB
Calc Crossreactivity:Ch Hu Mo Rt
Immunogen:Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled)