Cytokines and growth factors bind to specific cellular receptors that induce differential phosphorylation and activation of proteins called STATs (for Signal Transducers and Activators of Transcription).
STAT3 is phosphorylated on a tyrosine residue after treatment of cells with Epidermal Growth Factor and Interleukin-6.
It is not phosphorylated after treatment of cells with Interferon gamma.
Phosphorylated STAT3 can either form homodimers with itself or heterodimers with STAT1 alpha.
These complexes can bind to specific sequences in nuclear DNA and likely modulate gene transcription.
Applications:Suitable for use in Western Blot, Immunocytochemistry, Immunoprecipitation and Gel Shift Assay.
Other applications not tested.
Recommended Dilutions:Western Blot: 0.5-2ug/ml detects STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.
EGF-stimulated A431 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-STAT3 (2ug/ml).
Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemiluminescence detection system
Immunocytochemistry: 10ug/ml shows positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid
Immunoprecipitation: 4ug immunoprecipitates STAT 3 from 500ug of EGF-stimulated A431 RIPA lysate
Gel Shift Assay: This antibody supershifts
Optimal dilutions to be determined by researcher.
Positive Antigen Control (Included):A0001-55: EGF-stimulated A431 cell lysate.
Storage and Stability:Store product at 4°C if to be used immediately within two weeks.
For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20°C.
Aliquots are stable at -20°C for 12 months after receipt.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: FITC conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Specificity:Recognizes human STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species Crossreactivity: rat and mouse.
Isotype:IgG
Calc Applications Abbrev:IC IP WB
Calc Crossreactivity:Hu Mo Rt
Immunogen:Bacterially expressed GST fusion protein corresponding to human STAT3 (aa688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28aa are identical to mouse STAT3B.