Applications:Suitable for use in Western Blot and Immunoprecipitation.
Other applications have not been tested.
Recommended Dilution:Western Blot: 0.1–2ug/ml detects MAP kinases in RIPA lysates of mouse 3T3/A31 fibroblasts and L6 cells.
3T3/A31 cell lysate was resolved by electrophoresis, transferred to nitrocellulose and probed with anti-MAP Kinase 1/2 (0.1ug/ml).
Proteins were visualized using a goat anti-rabbit secondary antibody conjugated to HRP and a chemilum-inescence detection system.
Immunoprecipitation Kinase Assay: 4ug immunoprecipitates active MAP kinases from a lysate of NGF-stimulated (50ng/ml) PC-12 cells, as demonstrated using the MAPK Immunoprecipitation Kinase Cascade Kit.
Optimal dilutions to be determined by the researcher.
Positive Antigen Control for Western Blot:3T3/A31 cell lysate.
Use 20ug per lane for minigels.
Storage and Stability:Store product at 4°C.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:rat
Grade:Affinity Purified
Purity:Purified by immunoaffinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase.
Specificity:Recognizes rat MAPK1/Erk1 at 44kD and MAPK2/Erk2 at 42kD. Species Crossreactivity: Human, mouse, chicken and starfish. Species Sequence Homology: Chinese hamster: 35/35; mouse: 34/35; human: 32/35
Isotype:IgG
Calc Applications Abbrev:IP WB
Calc Crossreactivity:Ch Hu Mo Rt
Immunogen:Synthetic peptide (CGG-PFTFDMELDDLPKERLKELIFQETARFQPGAPEAP) corresponding to the C-terminal 35 amino acids of rat 44kD MAP Kinase 2/ Erk2 (KLH coupled)