MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection.
Lipopolysaccharide-induced tumor necrosis factor-alpha factor(LITAF) mediates the expression of inflammatory cytokines such as TNF-alpha in Lipopolysaccharide-induced processes.
LITAF binds to STAT6B, a member of the STAT6 family forming a complex on the TNF-alpha promoter that modulates TNF activity.
High levels of expression of LITAF mRNA have been observed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPSYYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCGSLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™750 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™750.
Specificity:Recognizes human LITAF.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Rb
Immunogen:Full length human LITAF, aa1-161 (NP_004853.2).