84-3326-69　［取扱停止］GNRH1 (Gonadotropin-releasing Hormone GnRH, GRH, Gonadotrophin Releasing Hormone 1, GnRH-I, Gonadoliberin I, Gonadoliberin-1, Gonadorelin, Luliberin I, Luteinizing Hormorne Releasing Hormone, LHRH, LH-RH I, LNRH, Luteinizing Releasing Hormone, Progonadoliberin-1 Precursor, Progonadoliberin I, Prolactin Release Inhibiting Factor) (MaxLight 750) 100ul　127447-ML750

特徴

• MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection.
• Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
• GNRH1 stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: MaxLight™750 conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.