84-3325-49 ［取扱停止］FNDC4 (FRCP1, Fibronectin Type III Domain-containing Protein 4, Fibronectin Type III Repeat-containing Protein 1, FLJ22362, UNQ6389/PRO21134) (MaxLight 750) 100ul 126921-ML750
84-3325-49 ［取扱停止］FNDC4 (FRCP1, Fibronectin Type III Domain-containing Protein 4, Fibronectin Type III Repeat-containing Protein 1, FLJ22362, UNQ6389/PRO21134) (MaxLight 750) 100ul 126921-ML750
MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection.
FNDC4 contains a fibronectin type-III (FN3) domain.
FN3 repeats have been found in various protein families including extracellular-matrix molecules, cell-surface receptors, enzymes, and muscle proteins.
The function of FNDC4 is unknown.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MPSGCHSSPPSGLRGDMASLVPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNIVIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRLPSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSPQGRPVGTRQKKSPSINTIDV
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™750 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™750.
Specificity：Recognizes human FNDC4.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human FNDC4, aa1-234 (NP_073734.1).
