MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection.
CD62E is also known as ELAM-1, E-selectin and LECAM-2.
CD62E binds to CD15s and thereby mediates neutrophil adhesion to endothelium.
CD62E is expressed on activated endothelium and on chronically inflamed skin and synovial lesions.
This antibody blocks skin homing human lymphocytes from binding to E-selectin transfected cells.
This antibody also inhibits binding of human neutrophils and human myeloid cells (HL60 cell line) to IL-1 stimulated human umbilical vein endothelial cells and E-selectin transfected cells.
CD62E is a member of a small family of proteins known as the selectins.
Members of the selectin family are characterized by the presence of three homologous domains.
Located at the N-terminus is the homologous calcium ion-dependent lectin related domain which mediates ligand binding.
Adjacent to the lectin related domain is the homologous EGF-related domain.
Between the EGFrelated domain and the cell membrane is the complement regulatory domain composed of repeats which bear homology with complement regulatory proteins (CRP's).
Each of the selectins also possesses a transmembrane domain and a short cytoplasmic domain which corresponds to the C-terminus of the protein.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELYGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESDGSYQKPSYIL
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™750 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™750.
Specificity:Recognizes human SELE.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human SELE, aa1-610 (NP_000441.1)