84-3317-77 [取扱停止]ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (MaxLight 750) 100ul 123553-ML750
84-3317-77 [取扱停止]ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (MaxLight 750) 100ul 123553-ML750
MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection.
This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression.
The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat.
Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.
This gene is closely localized with other family members on the X chromosome.
Three transcript variants encoding the same protein have been identified for this gene.
[provided by RefSeq].
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGYARKVGWVTAGLVIGAGACYCIYRLTRGRKQNKEKMAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIALGNNAAYAFNRDIIRDLGGLPIVAKILNTRDPIVKEKALIVLNNLSVNAENQRRLKVYMNQVCDDTITSRLNSSVQLAGLRLLTNMTVTNEYQHMLANSISDFFRLFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGSLFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™750 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™750.
Specificity:Recognizes human ARMCX3.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human ARMCX3, aa1-379 (NP_057691.1).