84-3316-79　［取扱停止］AKR1C1 (Aldo-keto Reductase Family 1 Member C1, 20-alpha-hydroxysteroid Dehydrogenase, 20-alpha-HSD, Chlordecone Reductase Homolog HAKRC, Dihydrodiol Dehydrogenase 1/2, DD1/DD2, High-affinity Hepatic Bile Acid-binding Protein, HBAB, Indanol Dehydrogenase, Trans-1,2-dihydrobenzene-1,2-diol Dehydrogenase, DDH, DDH1) (MaxLight 750) 100ul　123158-ML750

特徴

• MaxLight™750 is a new Near IR stable dye conjugate comparable to DyLight™750, Alexa Fluor™700 and offers better labeling efficiency, brighter imaging and increased immunodetection.
• Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
• The human aldo-keto reductases 1C1 and 1C3 (AKR1C1 and AKR1C3) have major roles in pre receptor regulation of progesterone action.
• They can both convert progesterone to the less potent efficiencies.
• AKR1C1 and AKR1C3 also act as 3-ketosteroid reductase, and as such they can convert the most potent androgen 5alpha-DHT into 3beta-andorstandiol, which is an estrogen receptor beta ligand, and into the inactive androgen 3alpha-androstnionl, respectively.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: MaxLight™750 conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.