MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
Stathmin 1, a neuron-enriched soluble phosphoprotein is a ubiquitous, phylogenetically conserved protein present in the cytoplasm of cells in a variety of unphosphorylated and phosphorylated forms.
Stathmin 1 is widely expressed in organisms ranging from Drosophila to humans and is especially highly expressed in the developing nervous system.
Its expression is also elevated in a number of leukemias and solid tumors, which has led to the suggestion that it may be involved in tumorigenesis.
The protein destabilizes microtubules and increases the frequency by which microtubule plus ends switch from growth to rapid shortening and thus plays an important role in linking cell signaling to the regulation of microtubule dynamics.
Human Stathmin 1 has been mapped to chromosomal region 1p36.1-p35.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity：Recognizes human STMN1. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human STMN1, aa1-149 (NP_005554.1).
