84-3201-28 Serum Amyloid A1 (SAA1, Amyloid Fibril Protein AA, Amyloid Protein A, MGC111216, PIG4, SAA2, Serum Amyloid A Protein Precursor, SAA, Tumor Protein p53 Inducible Protein 4, TP53I4) (MaxLight 650) 100ul 133201-ML650
84-3201-28 Serum Amyloid A1 (SAA1, Amyloid Fibril Protein AA, Amyloid Protein A, MGC111216, PIG4, SAA2, Serum Amyloid A Protein Precursor, SAA, Tumor Protein p53 Inducible Protein 4, TP53I4) (MaxLight 650) 100ul 133201-ML650
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
Human Serum Amyloid A protein-1 (SAA-1) is a multifunctional apolipoprotein produced by hepatocytes in response to proinflammatory cytokines.
It is secreted as a 12kD, 104aa, nonglycosylated polypeptide that displaces apoA1 in the HDL 3 complex.
The SAA-1 gene is one of three SAA genes in human, and it shows multiple alleles that are race dependent.
The SAA-1 gene product differs from the SAA-2 gene product by only seven amino acids.
Circulating SAA-1 shows multiple proteolytically-generated isoforms, with anywhere from one-to-three amino acids being cleaved from either the N- or C-terminus.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity:Recognizes human SAA1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human SAA1, aa1-122 (NP_000322.2).