84-3201-07 SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (MaxLight 650) 100ul 133125-ML650
84-3201-07 SEPT1 (Septin-1, LARP, Peanut-like Protein 3, Serologically Defined Breast Cancer Antigen NY-BR-24, DIFF6, PNUTL3) (MaxLight 650) 100ul 133125-ML650
MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
This gene is a member of the septin family of GTPases.
Members of this family are required for cytokinesis.
This gene encodes a protein associated with the tau-based paired helical filament core, and may contribute to the formation of neurofibrillary tangles in Alzheimer's disease.
SEPT2, otherwise known as septin-2, is a cytoskeletal GTPase and member of the septin family, essential for the formation of filaments, in conjunction with SEPT6 and SEPT7.
SEPT2 plays an important role during mitosis progression/cytokinesis, in the correct organization of the actin cytoskeleton, and maintains polyGlu microtubule tracks, thereby facilitating epithelial cell vesicle transport.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MDKEYVGFAALPNQLHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTNLYEDRQVPEASARLTQTLAIERRGVEIEEGGVKVKLTLVDTPGFGDSVDCSDCWLPVVKFIEEQFEQYLRDESGLNRKNIQDSRVHCCLYFISPFGRGLRPLDVAFLRAVHEKVNIIPVIGKADALMPQETQALKQKIRDQLKEEEIHIYQFPECDSDEDEDFKRQDAEMKESIPFAVVGSCEVVRDGGNRPVRGRRYSWGTVEVENPHHCDFLNLRRMLVQTHLQDLKEVTHDLLYEGYRARCLQSLARPGARDRASRSKLSRQSATEIPLPMLPLADTEKLIREKDEELRRMQEMLEKMQAQMQQSQAQGEQSDAL
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity:Recognizes human SEPT1.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human SEPT1, aa1-367 (NP_443070.1).