MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
RGS proteins are regulatory and structural components GPCR complexes.
These are GAPs for Gi and Gq class G-alpha proteins and negatively regulate GPCR signaling pathways.
RGS20, a 25kD protein, is a novel member of this family and is human homolog of bovine Gz-GAP.
It contains an N-terminal cysteine string that is potential site for multiple palmitoylation and a C-terminal RGS core domain.
RGS20 plays a vital role in regulating GPCR signals in brain, neuronal development and regulation of golgi structure.
It specifically interacts and accelerates the hydrolysis of G-alphaz.
Reports suggest that it interacts with G-alphai subunit and plays a significant role in regulation of G-alphai-mediated signaling.
It is a membrane-bound protein specifically expressed in brain, with highest concentrations in caudate nucleus and temporal lobe.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRTADGGEPAGASSPAGRVDGGLQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity：Recognizes human RGS20. Species Crossreactivity: mouse.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu Mo
Immunogen：Full length human RGS20, aa1-241 (NP_003693.2).
