84-3191-64　JAZF1 (TIP27, ZNF802, Juxtaposed with Another Zinc Finger Protein 1, TAK1-interacting Protein 27, Zinc Finger Protein 802, DKFZp761K2222) (MaxLight 650) 100ul　128681-ML650

特徴

• MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
• Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
• This gene encodes a nuclear protein with three C2H2-type zinc fingers, and functions as a transcriptional repressor.
• Chromosomal aberrations involving this gene are associated with endometrial stromal tumors.
• Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYGEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGCKKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: MaxLight™650 conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.