MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
Interleukin 24 (IL-24), also known as mda-7 (melanoma differentiation associated gene-7), is a newly discovered member of the IL-10 family of helical cytokines.
The IL-24 gene encodes a precursor protein of 207 amino acids (aa) that contains a 48 aa signal sequence and an 18kD, 158 aa mature segment.
There are three potential N-linked glycosylation sites, at least one of which is used.
When secreted, IL-24 is a 35-40kD phosphorylated glycoprotein that apparently can exist as either a monomer or dimer.
It is suggested that glycosylation is essential for activity.
Mature human IL-24 shares 69% aa sequence identity with mouse and rat IL-24.
Human IL-24 is active in rodent systems.
Cells known to express IL-24 include B cells, CD4+ T cells, NK cells, lymph node dendritic cells, monocytes, melanocytes, and melanoma cells.
Functionally, IL-24 has diverse activities.
At low concentrations on monocytes, it induces type I proinflammatory cytokines such as IFN-gamma, IL-1Beta, IL-12 and TNF-alpha.
At high concentrations, it is a strong inducer of apoptosis in tumor cells, but not in normal cells.
IL-24 also has anti-angiogenic properties.
It binds directly to IL-24 receptors on endothelial cells, activating STAT3 and blocking their differentiation.
IL-24 binds and signals through two heterodimeric receptor complexes.
One complex is the combination of IL-20 Ralpha.
and IL-20 RBeta, which is shared with IL-19 and IL-20.
The second complex is a combination of IL-22 R and IL-20 RBeta, which is shared with IL-20.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity：Recognizes human IL24.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length human IL24, aa1-206 (NP_006841.1).
