MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
This monoclonal antibody recognizes human IL-23, a heterodimeric cytokine composed of the p40 subunit shared with IL-12 and a specific p19 subunit.
This antibody recognizes heterodimeric IL-23, but does not react with the p40 subunit alone or recombinant IL-12(p70) when used as a capture antibody in FLISA.
IL-23 is secreted by activated dendritic cells and macrophages and has been shown to enhance IFN-y secretion by memory (CD45RO) T cells in an IL-2 dependent manner.
IL-23 may also induce unique Th subset (designated ThIL-17) that secretes the cytokines IL-17, IL-6, TNF and low levels of IFN-y.
IL-23 has been shown to promote immunity to mycobacteria and has been shown to be upregulated in response to some viral infections and in psoriatic lesions.
IL-23 binds to the IL-23 receptor comprised of a B1 subunit shared with the IL-12 receptor and IL-23-specific subunit.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity：Recognizes human IL23A.
Isotype：IgG
Calc Applications Abbrev：WB
Calc Crossreactivity：Hu
Immunogen：Full length protein corresponding to aa1-189 of human IL23A.
