MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
Edg-1 is a heterotrimeric orphan receptor for lysosphingolipid sphingosine 1-phosphate (S1P) and belongs to the G-protein coupled receptor 1 family with seven putative transmembrane domains.
Human Edg-1 is a highly inducible and abundant endothelial cell GPR that helps in the regulation of differentiation of endothelial cells.
S1P-induced endothelial cell migration requires the PKB:AKT1 mediated phosphorylation of Edg-1.
Activation of Edg-1 induces cell-cell adhesion and it also helps in modulating intracellular Ca2+ homeostasis.
It is rapidly induced when endothelial cells are treated with the tumor promoter phorbol 12-myristate 13-acetate (PMA) and super induced in the presence of cycloheximide.
Over expression of Edg-1 leads to cell-cell aggregation, enhanced expression of cadherins and formation of well-developed adherens junctions.
Edg-1 is widely expressed in many tissues with low expression in vascular smooth muscle cells, fibroblasts, melanocytes, and cells of epithelioid origin.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIMGWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSHPQKDEGDNPETIMSSGNVNSSS
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity:Recognizes human EDG1. Species Crossreactivity: mouse.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu Mo
Immunogen:Full length human EDG1, aa1-382 (NP_001391.2).