MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection.
CIDEA is a 24-27kD member of the CIDE family of molecules.
It is expressed in human adipocytes and striated muscle, plus mouse brown adipocytes and hepatocytes, and appears to have at least two functions.
In the cytoplasm of fat cells, CIDEA localizes to lipid droplets and ER, and promotes the formation of lipid droplets at the expense of lipolysis and AMPK activity.
In the nucleus, CIDEA apparently binds to LXR, and is capable of inducing apoptosis.
CIDEA undergoes O-linked glycosylation.
When glycosylated, CIDEA is nuclear; when nonglycosylated, CIDEA is cytoplasmic.
Human CIDEA is 219aa in length, and contains one CIDE domain aa33-110 that potentially mediates dimerization.
CIDEA reportedly homodimerizes, and heterodimerizes with CIDEB.
There is one potential isoform variant that possesses a 46aa substitution for aa1-12.
Over aa61-162, human CIDEA shares 89% aa identity with mouse CIDEA.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MRGDRASGGPGNHNGSWAREGPRLGPSWKRGLWSPRGGPNRPAEPSRPLTFMGSQTKRVLFTPLMHPARPFRVSNHDRSSRRGVMASSLQELISKTLDALVIATGLVTLVLEEDGTVVDTEEFFQTLGDNTHFMILEKGQKWMPGSQHVPTCSPPKRSGIARVTFDLYRLNPKDFIGCLNVKATMYEMYSVSYDIRCTGLKGLLRSLLRFLSYSAQVTGQFLIYLGTYMLRVLDDKEERPSLRSQAKGRFTCG
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™650 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Specificity:Recognizes human CIDEA.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human CIDEA, aa1-253 (NP_938031.1).