84-3063-71　SMAC (Diablo Homolog, Mitochondrial, Second Mitochondria-derived Activator Of Caspase, Smac, Direct IAP-binding Protein With Low pI, DIABLO, FLJ10537, FLJ25049) (MaxLight 550) 100ul　133533-ML550

特徴

• MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection.
• Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
• Second mitochondria-derived activator of caspase (SMAC) has been implicated in the activation of apoptosis in response to cell stress.
• SMAC promotes CASP9 activation by binding to IAPs and removing their inhibitory activity.
• The inhibitor of apoptosis proteins (IAPs) regulate programmed cell death by inhibiting members of the caspase family of enzymes.
• Smac/DIABLO is a mitochondrial protein that is released along with cytochrome c during apoptosis and activates cytochrome c/Apaf-1/caspase-9 pathway.
• Smac is an antagonist of the X-linked inhibitor of apoptosis (XIAP) - the most potent caspase inhibitor of all known inhibitor of apoptosis-family members.
• Smac promotes apoptosis by eliminating the inhibitory effect of inhibitor-of-apoptosis (IAPs) through physical interactions.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: MaxLight™550 conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.