84-3052-45　IFITM3 (Interferon-induced Transmembrane Protein 3, Dispanin Subfamily A Member 2b, DSPA2b, Interferon-inducible Protein 1-8U) (MaxLight 550) 100ul　128259-ML550

特徴

• MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection.
• Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
• FITM3 is a 14.6kD (predicted) member of the CD225 family of proteins.
• It is expressed on primordial germ cells and select tumor types, and appears to regulate cell migration.
• Human IFITM3 is a 133aa, two-transmembrene protein that contains an N-terminal aa1-57 and a C-terminal aa108-128 extracellular domain.
• Over aa3-57, human IFITM3 is 59% and 56% aa identical to bovine and mouse IFITM3, respectively.
• Over aa3-57 human IFITM3 is 88% identical to human IFITM2.
• Applications:Suitable for use in Western Blot.
• Other applications not tested.
• Recommended Dilution:Optimal dilutions to be determined by the researcher.
• AA Sequence:MSHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGGPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: MaxLight™550 conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.