MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection.
PAEP (Progesterone-associated endometrial protein, glycodelin, PEG, PP14) is a glycoprotein belonging to lipocalin structural superfamily.
It shares a sequence homology to beta-lactoglobulins containing a retinol-binding motif and it is mainly produced by secretory and decidualized endometrium in women and by seminal vesicle epithelium in men.
PAEP function is not clearly understood.
However, glycosylated version of PAEP (GdA) has been associated to contraceptive and immunosuppressive activities during reproduction.
PAEP is the main protein produced by secretory endometrium during mid-luteal phase of the menstrual cycle and during the first semester of pregnancy.
Therefore, PAEP has been linked as an ideal biomarker of endometrial activity and function for in vitro fertilization treated women.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™490 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Specificity:Recognizes human PAEP.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human PAEP, aa1-180 (NP_002562.2).