MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection.
CD79a, a 32-33KD membrane glycoprotein, is a member of Ig superfamily.
It heterodimerizes with CD79b and is non-covalently cross-linked with surface Ig thus forming the BCR complex.
It is expressed all stages of differentiation in mature B-cells and is required for cell surface expression and signal transduction by the BCR complex.
Upon antigen binding, CD79a/b heterodimer interacts with Tyrosine kinase (Lyn) and gets phosphorylated, resulting in the inititation of intracellular signaling cascade.
Pathological role of CD79a has been suggested in B-cell lymphomas and acute lymphoblastic leukemia.
CD79a is often used along with CD20 in the detection of normal and neoplastic B-cells in tissue sections.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MPGGPGVLQALPATIFLLFLLSAVYLGPGCQALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLIIQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIILLFCAVVPGTLLLFRKRWQNEKLGLDAGDEYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLNIGDVQLEKP
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™490 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™490.
Specificity:Recognizes human CD79A.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human CD79A, aa1-226 (NP_001774.1).