84-2903-01　ANGPTL3 (Angiopoietin-related Protein 3, Angiopoietin-5, ANG-5, Angiopoietin-like Protein 3, ANGPT5, FHBL2, UNQ153/PRO179) (MaxLight 490) 100ul　123318-ML490

特徴

• MaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection.
• Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
• Angiopoietin-like 3 (ANGPTL3 or ANGPT5), a liver specific protein, is a secreted factor consisting of an N-terminal coiled-coil domain and C-terminal fibrinogen-like domain.
• ANGPTL3 is structurally similar to angiopoietins, which are vascular endothelial growth factors.
• ANGTPLs (ANGTPL3, ANGPTL4 and ANGPTL6) have a major impact on lipid and possibly glucose metabolism.
• These proteins also have important effects on plasma triacylglycerol clearance, adipose tissue lipolysis, and adiposity.
• Applications:Suitable for use in Western Blot.
• Other applications have not been tested.
• Recommended Dilutions:Optimal dilutions to be determined by the researcher.
• Amino Acid Sequence:MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
• Storage and Stability:Store product at 4°C in the dark.
• DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
• Dilute required amount only prior to immediate use.
• Further dilutions can be made in assay buffer.
• Caution: MaxLight™490 conjugates are sensitive to light.
• For maximum recovery of product, centrifuge the original vial prior to removing the cap.
• Note: Applications are based on unconjugated antibody.