MaxLight™405 is a new Violet photostable dye conjugate comparable to Alexa Fluor® 405, PacificBlue™, Brilliant™ Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection.
The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions.
This protein interacts with androgen receptor (AR) and may function as a coactivator that induces AR target gene expression in prostate.
A dominant negative mutant of this gene has been demonstrated to inhibit the AR-mediated growth of prostate cancer.
This protein also interacts with class III ubiquitin-conjugating enzymes (E2s) and may act as a ubiquitin-ligase (E3) in the ubiquitination of certain nuclear proteins.
Five alternatively spliced transcript variants encoding two distinct isoforms have been reported.
Applications:Suitable for use in Western Blot and Immunofluorescence.
Other applications have not been tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MQFLKEETLAYLNIVSPFELKIGSQKKVQRRTAQASPNTELDFGGAAGSDVDQEEIVDERAVQDVESLSNLIQEILDFDQAQQIKCFNSKLFLCSICFCEKLGSECMYFLECRHVYCKACLKDYFEIQIRDGQVQCLNCPEPKCPSVATPGQVKELVEAELFARYDRLLLQSSLDLMADVVYCPRPCCQLPVMQEPGCTMGICSSCNFAFCTLCRLTYHGVSPCKVTAEKLMDLRNEYLQADEANKRLLDQRYGKRVIQKALEEMESKEWLEKNSKSCPCCGTPIEKLDGCNKMTCTGCMQYFCWICMGSLSRANPYKHFNDPGSPCFNRLFYAVDVDDDIWEDEVED
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™405 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size：100ul
Host：rabbit
Source Antibody：human
Grade：Affinity Purified
Purity：Purified by Protein A affinity chromatography.
Form：Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™405.
Specificity：Recognizes human RNF14.
Isotype：IgG
Calc Applications Abbrev：IF WB
Calc Crossreactivity：Hu
Immunogen：Full length protein corresponding to aa1-348 from human RNF14 (NP_899645.1).
