MaxLight™405 is a new Violet photostable dye conjugate comparable to Alexa Fluor® 405, PacificBlue™, Brilliant™ Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection.
REG3A, also known as Regenerating islet-derived protein 3 alpha, Reg III-alpha, and pancreatitis associated protein, is a 174aa containing stress protein involved in the control of bacterial proliferation.
This secreted protein is generally found in the apical region of pancreatic acinar cells and appears in pancreatic juice after induction of pancreatic inflammation.
It has a possible role in inducing new pancreatic islets development.
REG3A belongs to the Reg-related family with a C-type lectin domain and is constitutively expressed in intestine while low expression is found in healthy pancreas.
Overexpression of REG3A is seen during the acute phase of pancreatitis and in some patients with chronic pancreatitis.
Applications:Suitable for use in Western Blot.
Other applications not tested.
Recommended Dilution:Optimal dilutions to be determined by the researcher.
AA Sequence:MLPPMALPSVSWMLLSCLMLLSQVQGEEPQRELPSARIRCPKGSKAYGSHCYALFLSPKSWTDADLACQKRPSGNLVSVLSGAEGSFVSSLVKSIGNSYSYVWIGLHDPTQGTEPNGEGWEWSSSDVMNYFAWERNPSTISSPGHCASLSRSTAFLRWKDYNCNVRLPYVCKFTD
Storage and Stability:Store product at 4°C in the dark.
DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid.
Dilute required amount only prior to immediate use.
Further dilutions can be made in assay buffer.
Caution: MaxLight™405 conjugates are sensitive to light.
For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
仕様
Size:100ul
Host:rabbit
Source Antibody:human
Grade:Affinity Purified
Purity:Purified by Protein A affinity chromatography.
Form:Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™405.
Specificity:Recognizes human REG3A.
Isotype:IgG
Calc Applications Abbrev:WB
Calc Crossreactivity:Hu
Immunogen:Full length human REG3A, aa1-175 (NP_002571.1).